General Information

  • ID:  hor001912
  • Uniprot ID:  P07449
  • Protein name:  Glucagon-like peptide 1-1
  • Gene name:  gcg
  • Organism:  Oncorhynchus kisutch (Coho salmon) (Salmo kisutch)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HADGTYTSNVSTYLQDQAAKDFVSWLKSGRA
  • Length:  31
  • Propeptide:  HSEGTFSNDYSKYQEERMAQDFVQWLMNSXXXXXXXXHADGTYTSNVSTYLQDQAAKDFVSWLKSGRA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
  • Mechanism:  X's in the sequence were included by homology with American goosefish sequences.Gln-14 is a unique substitution from leucine in other known glucagon sequences and glucagon-like peptides.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001912_AF2.pdbhor001912_ESM.pdb

Physical Information

Mass: 395299 Formula: C150H226N42O50
Absent amino acids: CEIMP Common amino acids: AS
pI: 7.53 Basic residues: 4
Polar residues: 12 Hydrophobic residues: 10
Hydrophobicity: -64.84 Boman Index: -6380
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 56.77
Instability Index: 1700 Extinction Coefficient cystines: 8480
Absorbance 280nm: 282.67

Literature

  • PubMed ID:  3520699
  • Title:  Isolation and structures of coho salmon (Oncorhynchus kisutch) glucagon and glucagon-like peptide.